BTLA/CD272, Rat (HEK293, mFc)

Name: BTLA/CD272, Rat (HEK293, mFc)
Brand: QuantiMol
SKU: QM-0194770-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194770-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BTLA/CD272 protein inhibits antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. It regulates immune responses through cis and trans interactions with TNFRSF14. In cis, it maintains resting state in naive T cells, while in trans, it supports survival signals in effector T cells. BTLA/CD272 interacts with PTPN6/SHP-1, PTPN11/SHP-2, and TNFRSF14/HVEM. BTLA/CD272 Protein, Rat (HEK293, mFc) is the recombinant rat-derived BTLA/CD272 protein, expressed by HEK293 , with C-mFc labeled tag.
Molecular Formula
407756 (Gene_ID) Q6PNM1 (K30-Y183) (Accession)
Smiles
KEPTKRIGEECRVQLKIKRNSSRSAWTGELFKIECPVTYCVHRPNVTWCKHNGTRCVPLEVGPQLHTSWVENDQASAFVLYFEPIHLSDDGVYTCSANLNSEVINSHSVVIHVTERTQNCSEHPLITASDIPDATNASRPSTMEERPGRTWLLY
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194770-01	5 µgQM-0194770-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0194770-02	10 µgQM-0194770-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0194770-03	50 µgQM-0194770-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BTLA/CD272, Rat (HEK293, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.