BTN2A2, Human (Biotinylated, HEK293, Fc-Avi)
BTN2A2, Human (Biotinylated, HEK293, Fc-Avi)
SKU:QM-0100833
Request quote or documents

Product Details
-
Description
BTN2A2 protein inhibits CD4 and CD8 T-cell proliferation activated by anti-CD3 antibodies. It regulates T-cell metabolism, suppressing IL2 and IFNG cytokine secretion. BTN2A2 plays a pivotal role in immune response modulation, maintaining immune homeostasis by limiting T-cell activation and effector functions. BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN2A2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
-
Molecular Formula
10385 (Gene_ID) Q8WVV5 (Q33-V237) (Accession)
-
Smiles
QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
BTN2A2, Human (Biotinylated, HEK293, Fc-Avi)
BTN2A2, Human (Biotinylated, HEK293, Fc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.