Skip to product information
1 of 1

BTN3A2, Human (HEK293, His)

BTN3A2, Human (HEK293, His)

Size

SKU:QM-0206039

£570.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BTN3A2 Protein, Human (HEK293, His) is a recombinant human BTN3A2 produced in HEK293 cells, with His tag. BTN3A2 is a member of butyrophilin family[1].

  • Molecular Formula

    11118 (Gene_ID) P78410-1 (Q30-W248) (Accession)

  • Smiles

    QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWHHHHHH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0206039
50 µgQM-0206039
£570.02/ea
£0.00
£570.02/ea £0.00

BTN3A2, Human (HEK293, His)

BTN3A2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.