C1D, Human (His)

Name: C1D, Human (His)
Brand: QuantiMol
SKU: QM-0202569-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202569-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The C1D protein has multifunctionality in cellular processes, recruiting RNA exosome complexes for 5.8S rRNA processing, possibly in conjunction with MPHOSPH6. It activates PRKDC with linear and supercoiled DNA and induces apoptosis through the p53/TP53 pathway. C1D Protein, Human (His) is the recombinant human-derived C1D protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
10438 (Gene_ID) Q13901 (M1-S141) (Accession)
Smiles
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202569-01	5 µgQM-0202569-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0202569-02	10 µgQM-0202569-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0202569-03	50 µgQM-0202569-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0202569-04	100 µgQM-0202569-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

C1D, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.