C1orf33/MRTO4, Human (His)

Name: C1orf33/MRTO4, Human (His)
Brand: QuantiMol
SKU: QM-0204344-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204344-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
51154 (Gene_ID) Q9UKD2 (M1-D239) (Accession)
Smiles
MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204344-01	5 µgQM-0204344-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0204344-02	10 µgQM-0204344-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0204344-03	50 µgQM-0204344-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0204344-04	100 µgQM-0204344-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

C1orf33/MRTO4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.