Name: C1QA, Mouse (His-SUMO)
Brand: QuantiMol
SKU: QM-0193956-01
Price: 81.92 GBP
Availability: InStock

Product Details

Description
The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (His-SUMO) is the recombinant mouse-derived C1QA protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Molecular Formula
12259 (Gene_ID) P98086 (E23-A245) (Accession)
Smiles
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0193956-01	5 µgQM-0193956-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0193956-02	10 µgQM-0193956-02 £121.75/ea	£0.00	Quantity	£121.75/ea	£0.00

20 µgQM-0193956-03	20 µgQM-0193956-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0193956-04	50 µgQM-0193956-04 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0193956-05	100 µgQM-0193956-05 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0193956-06	500 µgQM-0193956-06 £1,412.02/ea	£0.00	Quantity	£1,412.02/ea	£0.00

1 mgQM-0193956-07	1 mgQM-0193956-07 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Item added to your cart