Skip to product information
1 of 1

CADM2/IGSF4D, Human (HEK293, His)

CADM2/IGSF4D, Human (HEK293, His)

Size

SKU:QM-0205143-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    253559 (Gene_ID) Q8N3J6-2 (G30-D335) (Accession)

  • Smiles

    GSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205143-01
2 µgQM-0205143-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0205143-02
5 µgQM-0205143-02
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0205143-03
10 µgQM-0205143-03
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0205143-04
50 µgQM-0205143-04
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205143-05
100 µgQM-0205143-05
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CADM2/IGSF4D, Human (HEK293, His)

CADM2/IGSF4D, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.