Name: Calcitonin/CALCA, Human (His)
Brand: QuantiMol
SKU: QM-0095445-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the C-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].
Molecular Formula
796 (Gene_ID) P01258-1 (Y58-N141) (Accession)
Smiles
YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0095445-01	2 µgQM-0095445-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0095445-02	10 µgQM-0095445-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0095445-03	50 µgQM-0095445-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0095445-04	100 µgQM-0095445-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0095445-05	500 µgQM-0095445-05 £1,433.88/ea	£0.00	Quantity	£1,433.88/ea	£0.00

1 mgQM-0095445-06	1 mgQM-0095445-06 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Calcitonin/CALCA, Human (His)

Calcitonin/CALCA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.