Skip to product information
1 of 1

Calcitonin R, Human (HEK293, hFc)

Calcitonin R, Human (HEK293, hFc)

Size

SKU:QM-0195857-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Calcitonin R protein, a receptor for calcitonin, utilizes G proteins to activate adenylyl cyclase. Despite being sensitive to cholera toxin, it exhibits limited coupling to G proteins, leading to the inability to effectively activate adenylyl cyclase. Notably, following ligand binding, Calcitonin R does not undergo the conventional process of receptor internalization. Calcitonin R Protein, Human (130a.a, HEK293, Fc) is the recombinant human-derived Calcitonin R, expressed by HEK293, with N-hFc labeled tag. The total length of Calcitonin R Protein, Human (130a.a, HEK293, Fc) is 130 a.a..

  • Molecular Formula

    799 (Gene_ID) P30988 (A25-V154) (Accession)

  • Smiles

    AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIV

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195857-01
5 µgQM-0195857-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0195857-02
10 µgQM-0195857-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0195857-03
50 µgQM-0195857-03
£288.14/ea
£0.00
£288.14/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Calcitonin R, Human (HEK293, hFc)

Calcitonin R, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.