Skip to product information
1 of 1

CALML3, Human (GST)

CALML3, Human (GST)

Size

SKU:QM-0085109

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    810 (Gene_ID) P27482 (M1-K149) (Accession)

  • Smiles

    MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0085109
1 EachQM-0085109
£0.00/ea
£0.00
£0.00/ea £0.00

CALML3, Human (GST)

CALML3, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.