CALML3, Human (GST)
CALML3, Human (GST)
SKU:QM-0085109
Request quote or documents

Product Details
-
Description
The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.
-
Molecular Formula
810 (Gene_ID) P27482 (M1-K149) (Accession)
-
Smiles
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CALML3, Human (GST)
CALML3, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.