Calreticulin/CALR, Mouse (P.pastoris, His)

Name: Calreticulin/CALR, Mouse (P.pastoris, His)
Brand: QuantiMol
SKU: QM-0194034-01
Price: 231.03 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194034-01

£231.03 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.
Molecular Formula
12317 (Gene_ID) P14211 (D18-L416) (Accession)
Smiles
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194034-01	5 µgQM-0194034-01 £231.03/ea	£0.00	Quantity	£231.03/ea	£0.00

10 µgQM-0194034-02	10 µgQM-0194034-02 £357.39/ea	£0.00	Quantity	£357.39/ea	£0.00

50 µgQM-0194034-03	50 µgQM-0194034-03 £825.17/ea	£0.00	Quantity	£825.17/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Calreticulin/CALR, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.