Skip to product information
1 of 1

Calreticulin/CALR, Pig (P.pastoris, His)

Calreticulin/CALR, Pig (P.pastoris, His)

Size

SKU:QM-0121144

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Calreticulin (CALR) is an essential calcium-binding chaperone involved in ER functions. It interacts with glycoproteins, facilitates NR3C1 nuclear export, regulates maternal gene expression, and aids in oocyte maturation. CALR is released during oocyte activation and prevents polyspermy. It forms an EIF2 complex with CELF1/CUGBP1, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5 and interacts with PDIA3/ERp57, SPACA9, TRIM21, PPIB, PDIA5, and CLCC1. Calreticulin/CALR Protein, Pig (P.pastoris, His) is the recombinant pig-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    100381266 (Gene_ID) P28491 (E18-L417) (Accession)

  • Smiles

    EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0121144
1 EachQM-0121144
£0.00/ea
£0.00
£0.00/ea £0.00

Calreticulin/CALR, Pig (P.pastoris, His)

Calreticulin/CALR, Pig (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.