Name: Can f 4, Canine (HEK293, His)
Brand: QuantiMol
SKU: QM-0077797-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
Can f 4 Protein, Canine (HEK293, His), an IgE-binding dog dander protein, is an important respiratory allergen. Can f 4 Protein is a dog allergen of the lipocalin family[1]. Can f 4 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 4 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
100463491 (Gene_ID) NP_001177855.1 (Q17-E174) (Accession)
Smiles
QLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVDIPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0077797-01	5 µgQM-0077797-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0077797-02	10 µgQM-0077797-02 £92.50/ea	£0.00	Quantity	£92.50/ea	£0.00

50 µgQM-0077797-03	50 µgQM-0077797-03 £255.34/ea	£0.00	Quantity	£255.34/ea	£0.00

100 µgQM-0077797-04	100 µgQM-0077797-04 £397.49/ea	£0.00	Quantity	£397.49/ea	£0.00

500 µgQM-0077797-05	500 µgQM-0077797-05 £1,024.43/ea	£0.00	Quantity	£1,024.43/ea	£0.00

1 mgQM-0077797-06	1 mgQM-0077797-06 £1,608.85/ea	£0.00	Quantity	£1,608.85/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Can f 4, Canine (HEK293, His)

Can f 4, Canine (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.