Carbonic Anhydrase 10, Mouse (HEK293, His)

Name: Carbonic Anhydrase 10, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0201694-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0201694-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
72605 (Gene_ID) P61215 (M1-N300) (Accession)
Smiles
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0201694-01	5 µgQM-0201694-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0201694-02	10 µgQM-0201694-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0201694-03	50 µgQM-0201694-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Carbonic Anhydrase 10, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.