Carbonic Anhydrase 3, Human (His)

Name: Carbonic Anhydrase 3, Human (His)
Brand: QuantiMol
SKU: QM-0196717-01
Price: 142.25 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0196717-01

£142.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-[1].
Molecular Formula
761 (Gene_ID) NP_005172.1 (A1-K260) (Accession)
Smiles
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Purity
97
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0196717-01	5 µgQM-0196717-01 £142.25/ea	£0.00	Quantity	£142.25/ea	£0.00

10 µgQM-0196717-02	10 µgQM-0196717-02 £246.31/ea	£0.00	Quantity	£246.31/ea	£0.00

50 µgQM-0196717-03	50 µgQM-0196717-03 £553.71/ea	£0.00	Quantity	£553.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Carbonic Anhydrase 3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.