Carbonic Anhydrase 5B, Human (His)

Name: Carbonic Anhydrase 5B, Human (His)
Brand: QuantiMol
SKU: QM-0177620-01
Price: 257.25 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0177620-01

£257.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Carbonic Anhydrase 5B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase V (CA-V) is a mitochondrial enzyme that provides bicarbonate for pyruvate carboxylase in liver and kidney[1].
Molecular Formula
11238 (Gene_ID) Q9Y2D0 (C34-P317) (Accession)
Smiles
CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATPHHHHHH
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0177620-01	10 µgQM-0177620-01 £257.25/ea	£0.00	Quantity	£257.25/ea	£0.00

50 µgQM-0177620-02	50 µgQM-0177620-02 £624.18/ea	£0.00	Quantity	£624.18/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Carbonic Anhydrase 5B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.