Carbonic Anhydrase 8, Mouse (His)

Name: Carbonic Anhydrase 8, Mouse (His)
Brand: QuantiMol
SKU: QM-0202451-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202451-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Despite its name, the carbonic anhydrase VIII (CA8) protein lacks carbonic anhydrase catalytic activity. This distinguishes CA8 from its typical functions related to carbonic anhydrase, an enzyme known for its ability to catalyze the reversible hydration of carbon dioxide. Carbonic Anhydrase 8 Protein, Mouse (His) is the recombinant mouse-derived Carbonic Anhydrase VIII/CA8 protein, expressed by E. coli , with C-His labeled tag.
Molecular Formula
12319 (Gene_ID) P28651 (M1-Q291) (Accession)
Smiles
MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202451-01	5 µgQM-0202451-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0202451-02	10 µgQM-0202451-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0202451-03	50 µgQM-0202451-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0202451-04	100 µgQM-0202451-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Carbonic Anhydrase 8, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.