Skip to product information
1 of 1

Carboxypeptidase B2/CPB2, Mouse (HEK293, His)

Carboxypeptidase B2/CPB2, Mouse (HEK293, His)

Size

SKU:QM-0204902-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    56373 (Gene_ID) Q9JHH6 (F22-T422) (Accession)

  • Smiles

    FQSGQVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPRASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204902-01
5 µgQM-0204902-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0204902-02
10 µgQM-0204902-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0204902-03
50 µgQM-0204902-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0204902-04
100 µgQM-0204902-04
£370.76/ea
£0.00
£370.76/ea £0.00
500 µgQM-0204902-05
500 µgQM-0204902-05
£946.67/ea
£0.00
£946.67/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Carboxypeptidase B2/CPB2, Mouse (HEK293, His)

Carboxypeptidase B2/CPB2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.