Skip to product information
1 of 1

Carboxypeptidase B2/CPB2, Rat (HEK293, His)

Carboxypeptidase B2/CPB2, Rat (HEK293, His)

Size

SKU:QM-0205853-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Carboxypeptidase B2 (CPB2) protein acts as an enzyme that cleaves C-terminal arginine or lysine residues from biologically active peptides, including kinins or anaphylatoxins circulating in the blood, thereby regulating their activity. Furthermore, CPB2 plays a key role in downregulating fibrinolysis by removing C-terminal lysine residues from fibrin that has been partially degraded by plasmin. Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His) is the recombinant rat-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    113936 (Gene_ID) Q9EQV9 (F22-S422) (Accession)

  • Smiles

    FQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIRNS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205853-01
5 µgQM-0205853-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0205853-02
10 µgQM-0205853-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0205853-03
50 µgQM-0205853-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0205853-04
100 µgQM-0205853-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0205853-05
500 µgQM-0205853-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00
1 mgQM-0205853-06
1 mgQM-0205853-06
£1,710.90/ea
£0.00
£1,710.90/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Carboxypeptidase B2/CPB2, Rat (HEK293, His)

Carboxypeptidase B2/CPB2, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.