Skip to product information
1 of 1

CART, Human (HEK293, Fc)

CART, Human (HEK293, Fc)

Size

SKU:QM-0203553-01

£64.33 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293, Fc) is the recombinant human-derived CART protein, expressed by HEK293 , with C-mFc labeled tag.

  • Molecular Formula

    9607 (Gene_ID) Q16568 (Q28-L116) (Accession)

  • Smiles

    QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203553-01
5 µgQM-0203553-01
£64.33/ea
£0.00
£64.33/ea £0.00
10 µgQM-0203553-02
10 µgQM-0203553-02
£99.25/ea
£0.00
£99.25/ea £0.00
50 µgQM-0203553-03
50 µgQM-0203553-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203553-04
100 µgQM-0203553-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CART, Human (HEK293, Fc)

CART, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.