Cathepsin B, Mouse (HEK293, His)

Name: Cathepsin B, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0200753-01
Price: 125.13 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0200753-01

£125.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Cathepsin B Protein, Mouse (HEK293, His) is an approximately 32-50 kDa Cathepsin B protein with a His-flag. Cathepsin B is an enzymatic protein belonging to the peptidase C1 family[1].
Molecular Formula
13030 (Gene_ID) P10605 (H18-F339) (Accession)
Smiles
HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH
Purity
98.3
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0200753-01	5 µgQM-0200753-01 £125.13/ea	£0.00	Quantity	£125.13/ea	£0.00

10 µgQM-0200753-02	10 µgQM-0200753-02 £221.31/ea	£0.00	Quantity	£221.31/ea	£0.00

50 µgQM-0200753-03	50 µgQM-0200753-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

100 µgQM-0200753-04	100 µgQM-0200753-04 £764.42/ea	£0.00	Quantity	£764.42/ea	£0.00

500 µgQM-0200753-05	500 µgQM-0200753-05 £1,585.76/ea	£0.00	Quantity	£1,585.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Cathepsin B, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.