Skip to product information
1 of 1

CBS, Human (His)

CBS, Human (His)

Size

SKU:QM-0200420-01

£94.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    875 (Gene_ID) P35520 (P2-K551) (Accession)

  • Smiles

    PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200420-01
5 µgQM-0200420-01
£94.75/ea
£0.00
£94.75/ea £0.00
10 µgQM-0200420-02
10 µgQM-0200420-02
£143.13/ea
£0.00
£143.13/ea £0.00
20 µgQM-0200420-03
20 µgQM-0200420-03
£249.26/ea
£0.00
£249.26/ea £0.00
50 µgQM-0200420-04
50 µgQM-0200420-04
£404.78/ea
£0.00
£404.78/ea £0.00
100 µgQM-0200420-05
100 µgQM-0200420-05
£616.19/ea
£0.00
£616.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CBS, Human (His)

CBS, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.