CCL11, Rat

Name: CCL11, Rat
Brand: QuantiMol
SKU: QM-0202390-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202390-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL11 protein directly promotes eosinophil accumulation in allergic reactions, selectively affecting eosinophils without influencing other immune cells. It binds to CCR3, emphasizing its role in eosinophil-mediated processes. The interaction between CCL11 and its receptor provides insights into the regulation of allergic reactions. CCL11 Protein, Rat is the recombinant rat-derived CCL11 protein, expressed by E. coli , with tag free.
Molecular Formula
29397 (Gene_ID) P97545 (H24-P97) (Accession)
Smiles
HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202390-01	2 µgQM-0202390-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202390-02	10 µgQM-0202390-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0202390-03	50 µgQM-0202390-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0202390-04	100 µgQM-0202390-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCL11, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.