CCL24/Eotaxin-2, Mouse

Name: CCL24/Eotaxin-2, Mouse
Brand: QuantiMol
SKU: QM-0187283-01
Price: 143.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0187283-01

£143.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL24/Eotaxin-2 Protein, Mouse is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].
Molecular Formula
56221 (Gene_ID) Q9JKC0 (V27-V119) (Accession)
Smiles
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0187283-01	10 µgQM-0187283-01 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0187283-02	50 µgQM-0187283-02 £431.51/ea	£0.00	Quantity	£431.51/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCL24/Eotaxin-2, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.