CCL24/Eotaxin-2, Rat

Name: CCL24/Eotaxin-2, Rat
Brand: QuantiMol
SKU: QM-0204078-01
Price: 80.89 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204078-01

£80.89 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL24/Eotaxin-2 Protein, Rat is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Rat is a recombinant rat CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].
Molecular Formula
288593 (Gene_ID) Q5PPP2 (V27-V119) (Accession)
Smiles
VTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204078-01	5 µgQM-0204078-01 £80.89/ea	£0.00	Quantity	£80.89/ea	£0.00

10 µgQM-0204078-02	10 µgQM-0204078-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0204078-03	50 µgQM-0204078-03 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

100 µgQM-0204078-04	100 µgQM-0204078-04 £591.89/ea	£0.00	Quantity	£591.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCL24/Eotaxin-2, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.