CCL4, Rat

Name: CCL4, Rat
Brand: QuantiMol
SKU: QM-0182084-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg

SKU:QM-0182084-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.
Molecular Formula
116637 (Gene_ID) P50230 (A24-N92) (Accession)
Smiles
APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0182084-01	2 µgQM-0182084-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0182084-02	10 µgQM-0182084-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCL4, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.