CCL6, Mouse

Name: CCL6, Mouse
Brand: QuantiMol
SKU: QM-0197660-01
Price: 81.92 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0197660-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].
Molecular Formula
20305 (Gene_ID) P27784 (G22-A116) (Accession)
Smiles
GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0197660-01	5 µgQM-0197660-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0197660-02	10 µgQM-0197660-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0197660-03	50 µgQM-0197660-03 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCL6, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.