1 1

CCND2, Human (His)

CCND2, Human (His)

Size

QM-0166899

Price on request

Request quote or documents

View full details

Product Details

  • Description

    CCND2 Protein, Human (His) is a D-type cyclin with key roles in cell cycle regulation, differentiation, and malignant transformation.

  • Molecular Formula

    894 (Gene_ID) P30279 (M1-L289) (Accession)

  • Smiles

    HHHHHHMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0166899
1 EachQM-0166899
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

CCND2, Human (His)

CCND2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.