Skip to product information
1 of 1

CCR5, Mouse (P. pastoris, His)

CCR5, Mouse (P. pastoris, His)

Size

SKU:QM-0198397-01

£323.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CCR5 protein is a receptor for inflammatory CC chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, and plays a crucial role in signal transduction by increasing intracellular calcium levels. . It acts as a chemoattractant receptor and contributes to granulocyte lineage control and T lymphocyte migration to sites of infection. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    12774 (Gene_ID) P51682 (Q263-L354) (Accession)

  • Smiles

    QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0198397-01
20 µgQM-0198397-01
£323.38/ea
£0.00
£323.38/ea £0.00
50 µgQM-0198397-02
50 µgQM-0198397-02
£568.80/ea
£0.00
£568.80/ea £0.00
100 µgQM-0198397-03
100 µgQM-0198397-03
£879.85/ea
£0.00
£879.85/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CCR5, Mouse (P. pastoris, His)

CCR5, Mouse (P. pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.