CCR9-VLP, Human (HEK293, His)

Name: CCR9-VLP, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0197853-01
Price: 636.85 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0197853-01

£636.85 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CCR9 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
Molecular Formula
10803 (Gene_ID) P51686-1 (M1-L369) (Accession)
Smiles
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0197853-01	20 µgQM-0197853-01 £636.85/ea	£0.00	Quantity	£636.85/ea	£0.00

50 µgQM-0197853-02	50 µgQM-0197853-02 £990.41/ea	£0.00	Quantity	£990.41/ea	£0.00

100 µgQM-0197853-03	100 µgQM-0197853-03 £1,433.88/ea	£0.00	Quantity	£1,433.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CCR9-VLP, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.