Name: CD133/PROM1, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205431-01
Price: 72.61 GBP
Availability: InStock

Product Details

Description
The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag.
Molecular Formula
60357 (Gene_ID) NP_001103607.1 (N171-Y424) (Accession)
Smiles
NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLQSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205431-01	5 µgQM-0205431-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0205431-02	10 µgQM-0205431-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0205431-03	50 µgQM-0205431-03 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

100 µgQM-0205431-04	100 µgQM-0205431-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0205431-05	500 µgQM-0205431-05 £1,289.30/ea	£0.00	Quantity	£1,289.30/ea	£0.00

1 mgQM-0205431-06	1 mgQM-0205431-06 £2,153.16/ea	£0.00	Quantity	£2,153.16/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD133/PROM1, Rat (HEK293, Fc)

CD133/PROM1, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.