1 1

CD150/SLAMF1, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1, Human (Biotinylated, HEK293, His-Avi)

Size

QM-0197683-01

£392.63 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    CD150/SLAMF1 protein is an autoligand receptor in the SLAM family, which can regulate the activation and differentiation of immune cells and affect innate and adaptive immune responses. Its activity depends on the cytoplasmic adapters SH2D1A/SAP and/or SH2D1B/EAT-2. CD150/SLAMF1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD150/SLAMF1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

  • Smiles

    ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0197683-01
20 µgQM-0197683-01
£392.63/ea		 £0.00
£392.63/ea £0.00
50 µgQM-0197683-02
50 µgQM-0197683-02
£664.79/ea		 £0.00
£664.79/ea £0.00
100 µgQM-0197683-03
100 µgQM-0197683-03
£1,035.37/ea		 £0.00
£1,035.37/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD150/SLAMF1, Human (Biotinylated, HEK293, His-Avi)

CD150/SLAMF1, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.