CD157, Mouse (HEK293, His)

Name: CD157, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0123768-01
Price: 111.63 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0123768-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD157 Protein, Mouse (HEK293, His) is a recombinant mouse CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].
Molecular Formula
12182 (Gene_ID) Q64277 (A25-E285) (Accession)
Smiles
ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0123768-01	10 µgQM-0123768-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0123768-02	50 µgQM-0123768-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD157, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.