Skip to product information
1 of 1

CD158d/KIR2DL4, Human (HEK293, His)

CD158d/KIR2DL4, Human (HEK293, His)

Size

SKU:QM-0203209-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential[1][2].

  • Molecular Formula

    3805 (Gene_ID) ADY38409.1 (W22-H242) (Accession)

  • Smiles

    WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

  • Purity

    97.05

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203209-01
5 µgQM-0203209-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203209-02
10 µgQM-0203209-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0203209-03
50 µgQM-0203209-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0203209-04
100 µgQM-0203209-04
£369.55/ea
£0.00
£369.55/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD158d/KIR2DL4, Human (HEK293, His)

CD158d/KIR2DL4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.