CD158d/KIR2DL4, Human (HEK293, His)

Name: CD158d/KIR2DL4, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0203209-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203209-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential[1][2].
Molecular Formula
3805 (Gene_ID) ADY38409.1 (W22-H242) (Accession)
Smiles
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
Purity
97.05
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203209-01	5 µgQM-0203209-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203209-02	10 µgQM-0203209-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203209-03	50 µgQM-0203209-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0203209-04	100 µgQM-0203209-04 £369.55/ea	£0.00	Quantity	£369.55/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD158d/KIR2DL4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.