CD160, Human (HEK293, His)

Name: CD160, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0192990-01
Price: 91.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0192990-01

£91.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD160 Protein, Human (HEK293, His) is a recombinant human CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1][2].
Molecular Formula
11126 (Gene_ID) O95971-1 (I27-S159) (Accession)
Smiles
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0192990-01	10 µgQM-0192990-01 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0192990-02	50 µgQM-0192990-02 £266.27/ea	£0.00	Quantity	£266.27/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD160, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.