CD160, Mouse (HEK293, His)

Name: CD160, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0178556-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0178556-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD160 Protein, Mouse (HEK293, His) is a recombinant mouse CD160 expressed in HEK 293 cells with a His tag at the N-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8+ T‐cell activation[1][2].
Molecular Formula
54215 (Gene_ID) Q8VC80 (G28-S160) (Accession)
Smiles
GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0178556-01	10 µgQM-0178556-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0178556-02	50 µgQM-0178556-02 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD160, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.