Skip to product information
1 of 1

CD164, Cynomolgus (HEK293, Fc)

CD164, Cynomolgus (HEK293, Fc)

Size

SKU:QM-0203321-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD164 Protein, a sialomucin, potentially plays a pivotal role in hematopoiesis, facilitating CD34+ cell adhesion while negatively regulating CD34+ cell proliferation[1]. CD164 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    102136974 (Gene_ID) XP_005551610 (N26-D163) (Accession)

  • Smiles

    NPTPHTNVTSLAPTSNITSAPVTSLPLVTTPAPETCEGRNSCVSCFNASTVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVVPTATLVPTANSTAKPTVQPSPSTTSKTVTTSGTTNTTVTPTSQPVRKSTFD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203321-01
5 µgQM-0203321-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0203321-02
10 µgQM-0203321-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0203321-03
50 µgQM-0203321-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0203321-04
100 µgQM-0203321-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD164, Cynomolgus (HEK293, Fc)

CD164, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.