CD164, Human (HEK293, His)

Name: CD164, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202883-01
Price: 74.68 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202883-01

£74.68 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD164 is a sialylamucin that may play a key role in the hematopoietic process, promoting CD34 (+) cell adhesion while negatively regulating CD34 (+) CD38 (lo/-) cell proliferation. It regulates cord blood CD133+ cell migration through the CXCL12/CXCR4 axis and is associated with prostate cancer metastasis and bone marrow invasion. CD164 Protein, Human (HEK293, His) is the recombinant human-derived CD164 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
8763 (Gene_ID) Q04900-1 (D24-D162) (Accession)
Smiles
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202883-01	5 µgQM-0202883-01 £74.68/ea	£0.00	Quantity	£74.68/ea	£0.00

10 µgQM-0202883-02	10 µgQM-0202883-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0202883-03	50 µgQM-0202883-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0202883-04	100 µgQM-0202883-04 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD164, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.