1 1

CD19, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD19, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Size

QM-0117393

Price on request

Request quote or documents

View full details

Product Details

  • Description

    CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD19 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    102145514/705211 (Gene_ID) XP_005591597.1/F7F486 (P20-K292) (Accession)

  • Smiles

    PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0117393
1 EachQM-0117393
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

CD19, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD19, Cynomolgus/Rhesus Macaque (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.