CD19, Mouse (HEK293, His)

Name: CD19, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0203582-01
Price: 62.26 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203582-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
12478 (Gene_ID) P25918 (R19-G287) (Accession)
Smiles
GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Purity
95.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203582-01	2 µgQM-0203582-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0203582-02	10 µgQM-0203582-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0203582-03	50 µgQM-0203582-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0203582-04	100 µgQM-0203582-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD19, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.