Skip to product information
1 of 1

CD1D, Human (His-SUMO)

CD1D, Human (His-SUMO)

Size

SKU:QM-0167583

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..

  • Molecular Formula

    912 (Gene_ID) P15813 (E20-S301) (Accession)

  • Smiles

    EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0167583
1 EachQM-0167583
£0.00/ea
£0.00
£0.00/ea £0.00

CD1D, Human (His-SUMO)

CD1D, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.