1 1

CD20/MS4A1, Cynomolgus (85a.a, HEK293, His)

CD20/MS4A1, Cynomolgus (85a.a, HEK293, His)

Size

QM-0194015-01

£76.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His) is the recombinant cynomolgus-derived CD20/MS4A1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    102118491 (Gene_ID) NP_001274241 (E213-P297) (Accession)

  • Smiles

    ENEWRRTCSRPKSSVVLLSAEEKKEQVIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0194015-01
5 µgQM-0194015-01
£76.75/ea		 £0.00
£76.75/ea £0.00
10 µgQM-0194015-02
10 µgQM-0194015-02
£111.63/ea		 £0.00
£111.63/ea £0.00
50 µgQM-0194015-03
50 µgQM-0194015-03
£293.00/ea		 £0.00
£293.00/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD20/MS4A1, Cynomolgus (85a.a, HEK293, His)

CD20/MS4A1, Cynomolgus (85a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.