CD27/TNFRSF7, Mouse (HEK293, His-Fc)

Name: CD27/TNFRSF7, Mouse (HEK293, His-Fc)
Brand: QuantiMol
SKU: QM-0189469-01
Price: 91.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0189469-01

£91.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.
Molecular Formula
21940 (Gene_ID) P41272 (P24-R182) (Accession)
Smiles
PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0189469-01	10 µgQM-0189469-01 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0189469-02	50 µgQM-0189469-02 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD27/TNFRSF7, Mouse (HEK293, His-Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.