Name: CD276/B7-H3, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0205627-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
315716 (Gene_ID) Q7TPB4 (V29-F244) (Accession)
Smiles
VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205627-01	5 µgQM-0205627-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205627-02	10 µgQM-0205627-02 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

50 µgQM-0205627-03	50 µgQM-0205627-03 £255.34/ea	£0.00	Quantity	£255.34/ea	£0.00

100 µgQM-0205627-04	100 µgQM-0205627-04 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

500 µgQM-0205627-05	500 µgQM-0205627-05 £946.67/ea	£0.00	Quantity	£946.67/ea	£0.00

1 mgQM-0205627-06	1 mgQM-0205627-06 £1,572.39/ea	£0.00	Quantity	£1,572.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD276/B7-H3, Rat (HEK293, His)

CD276/B7-H3, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.