1 1

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, His)

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, His)

Size

QM-0192581-01

£107.13 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant human-derived CD28 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Molecular Formula

    940/102146670/705313 (Gene_ID) P10747-1/Q0PDN3/Q0PDN4 (N19-P152) (Accession)

  • Smiles

    NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0192581-01
10 µgQM-0192581-01
£107.13/ea		 £0.00
£107.13/ea £0.00
50 µgQM-0192581-02
50 µgQM-0192581-02
£316.08/ea		 £0.00
£316.08/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, His)

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.