CD299, Human (HEK293, hFc)

Name: CD299, Human (HEK293, hFc)
Brand: QuantiMol
SKU: QM-0199473-01
Price: 76.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0199473-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.
Molecular Formula
10332 (Gene_ID) Q9H2X3-1/NP_055072.3 (S78-E399) (Accession)
Smiles
SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Purity
90.1
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0199473-01	5 µgQM-0199473-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0199473-02	10 µgQM-0199473-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0199473-03	50 µgQM-0199473-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CD299, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.