Skip to product information
1 of 1

CD3 epsilon, Cynomolgus (HEK293, Fc)

CD3 epsilon, Cynomolgus (HEK293, Fc)

Size

SKU:QM-0180346-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CD3E/CD3 epsilon 1-27 peptide is critical in the TCR-CD3 complex, transmitting signals during T cell activation. When APC activates the TCR, CD3E undergoes LCK/FYN-mediated phosphorylation together with ITAM, initiating downstream signaling. CD3 epsilon Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 epsilon protein, expressed by HEK293 , with C-Fc, C-hFc labeled tag.

  • Molecular Formula

    102133065 (Gene_ID) Q95LI5 (Q22-D117) (Accession)

  • Smiles

    QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

  • Purity

    96.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180346-01
10 µgQM-0180346-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0180346-02
50 µgQM-0180346-02
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD3 epsilon, Cynomolgus (HEK293, Fc)

CD3 epsilon, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.