Skip to product information
1 of 1

CD3 epsilon, Human (HEK293, His)

CD3 epsilon, Human (HEK293, His)

Size

SKU:QM-0187451-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (HEK293, His) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    916 (Gene_ID) P07766 (D23-D126) (Accession)

  • Smiles

    DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187451-01
10 µgQM-0187451-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0187451-02
50 µgQM-0187451-02
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0187451-03
100 µgQM-0187451-03
£492.26/ea
£0.00
£492.26/ea £0.00
500 µgQM-0187451-04
500 µgQM-0187451-04
£1,267.43/ea
£0.00
£1,267.43/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CD3 epsilon, Human (HEK293, His)

CD3 epsilon, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.