1 1

CD30/TNFRSF8, Cynomolgus (194a.a, HEK293, His)

CD30/TNFRSF8, Cynomolgus (194a.a, HEK293, His)

Size

QM-0197309-01

£76.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Cynomolgus (194a.a, HEK293, His) is the recombinant cynomolgus-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    102137811 (Gene_ID) XP_015298065 (M1-G194) (Accession)

  • Smiles

    MPLRGGTRLAQEAASKLTRAPGSPSSVGRPSSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMICATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPVGTQPDCSPTPENGEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAG

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0197309-01
10 µgQM-0197309-01
£76.75/ea		 £0.00
£76.75/ea £0.00
50 µgQM-0197309-02
50 µgQM-0197309-02
£216.46/ea		 £0.00
£216.46/ea £0.00
100 µgQM-0197309-03
100 µgQM-0197309-03
£316.08/ea		 £0.00
£316.08/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

CD30/TNFRSF8, Cynomolgus (194a.a, HEK293, His)

CD30/TNFRSF8, Cynomolgus (194a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.