Skip to product information
1 of 1

CD300a/LMIR1, Mouse (HEK293, Fc)

CD300a/LMIR1, Mouse (HEK293, Fc)

Size

SKU:QM-0126913

Price on request
Quantity

Request quote or documents

View full details
  • Description

    CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    217303 (Gene_ID) Q6SJQ0-1 (L28-R183) (Accession)

  • Smiles

    LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0126913
1 EachQM-0126913
£0.00/ea
£0.00
£0.00/ea £0.00

CD300a/LMIR1, Mouse (HEK293, Fc)

CD300a/LMIR1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.