CD300a/LMIR1, Mouse (HEK293, Fc)
CD300a/LMIR1, Mouse (HEK293, Fc)
SKU:QM-0126913
Request quote or documents

Product Details
-
Description
CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
217303 (Gene_ID) Q6SJQ0-1 (L28-R183) (Accession)
-
Smiles
LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CD300a/LMIR1, Mouse (HEK293, Fc)
CD300a/LMIR1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.